Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0637800_circ_g.4 |
| ID in PlantcircBase | osa_circ_015725 |
| Alias | Os02circ19797 |
| Organism | Oryza sativa |
| Position | chr2: 25572752-25572992 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0637800 |
| Parent gene annotation |
Hypothetical conserved gene. (Os02t0637800-01);Protein of unknow n function DUF639 family protein. (Os02t0637800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0637800-02:1 Os02t0637800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.291301694 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25572819-25572953(-) 25572770-25572953(-) |
| Potential amino acid sequence |
MFDMMLAWEHPGAVVEDELSENGSCSCNRNLAAKL*(-) MNYQKMVLALATETLQQNFEVDYPDSCKESNTYAKEFLEYCCHKALHEVTTRPDHLADKNLRRL MFDMMLAWEHPGAVVEDELSENGSCSCNRNLAAKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |