Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0114500_circ_g.15 |
| ID in PlantcircBase | osa_circ_038415 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 1163604-1165448 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0114500 |
| Parent gene annotation |
Kinesin-4 protein with transcription regulation activity, Cell c ycle and wall modification, Cell elongation by regulating GA bio synthesis pathway (Os09t0114500-01);Similar to Kinesin-like prot ein. (Os09t0114500-02);Similar to FRA1 (FRAGILE FIBER 1); microt ubule motor. (Os09t0114500-03);Hypothetical protein. (Os09t01145 00-04) |
| Parent gene strand | + |
| Alternative splicing | Os09g0114500_circ_g.16 Os09g0114500_circ_g.17 Os09g0114500_circ_g.18 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0114500-01:9 Os09t0114500-03:9 Os09t0114500-02:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149003744 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1163611-1163610(+) |
| Potential amino acid sequence |
MKMYGSDTVALKQHFGKKLLELEEEKRAVQQERDRLLAEVESLNADGQTHKLRDAQLQKLKTLE AQILDLKKKQENQVQLLKEKQKSDEAAKKLQEEIHSIKAQKVQLQHKIKQEAEQFRQWKATREK ELLQLRKEGRRNEYERHKLQALNQRQKLVLQRKTEEAAMATKRLKELLEARKSSGRDNSGMNGT SPGSHMTEKSLQKWLEQDLEVMVHVHEVRNEYEKQSQLRAALGEELAILKQEDVMSGAASPPRG KNGNSSLR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |