Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0604000_circ_g.1 |
| ID in PlantcircBase | osa_circ_034683 |
| Alias | Os_ciR11078 |
| Organism | Oryza sativa |
| Position | chr7: 24739152-24739629 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0604000 |
| Parent gene annotation |
Similar to 6-phosphogluconolactonase-like protein. (Os07t0604000 -01);Similar to 6-phosphogluconolactonase-like protein. (Os07t06 04000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0604000-01:2 Os07t0604000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007319* |
| PMCS | 0.825178587 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24739204-24739175(+) |
| Potential amino acid sequence |
MEREISALYEPKRNNEIRIFESSDEMSTDLAEYISQVSEISVKERGYFAIALSGGPLVSFLGKL CEAPYNKTLDWSKWYIFWSDERAVAKNHAESNYRITKEGFLSKAYFGGIVT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |