Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0604000_circ_g.1 |
ID in PlantcircBase | osa_circ_034683 |
Alias | Os_ciR11078 |
Organism | Oryza sativa |
Position | chr7: 24739152-24739629 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0604000 |
Parent gene annotation |
Similar to 6-phosphogluconolactonase-like protein. (Os07t0604000 -01);Similar to 6-phosphogluconolactonase-like protein. (Os07t06 04000-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0604000-01:2 Os07t0604000-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007319* |
PMCS | 0.825178587 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24739204-24739175(+) |
Potential amino acid sequence |
MEREISALYEPKRNNEIRIFESSDEMSTDLAEYISQVSEISVKERGYFAIALSGGPLVSFLGKL CEAPYNKTLDWSKWYIFWSDERAVAKNHAESNYRITKEGFLSKAYFGGIVT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |