Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0110300_circ_g.2 |
| ID in PlantcircBase | osa_circ_026225 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 552509-553385 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0110300 |
| Parent gene annotation |
Similar to NAD-dependent epimerase/dehydratase. (Os05t0110300-01 );Similar to NAD-dependent epimerase/dehydratase. (Os05t0110300- 02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0110300-02:4 Os05t0110300-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005907* osi_circ_015978 |
| PMCS | 0.247111536 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
552707-552575(+) 552685-553368(-) |
| Potential amino acid sequence |
MKPGFDPSKGGRPEFYFEDGSYPEQVDWIGQRNQIDAAKSIGVKQVVLVGSMGGTDVNHPLNKL GNANILVWKRKAEQYLADSGLPYTIIRPDCVQEAQGEGRPICGERASQD*(+) MISASMPSMAGAMLAGSLMSPTNTSAAPPILALLSSVLTSPLPTNWSALSLSFLYTIWPYNCIW *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |