Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0450800_circ_g.1 |
| ID in PlantcircBase | osa_circ_037249 |
| Alias | Os08circ10355 |
| Organism | Oryza sativa |
| Position | chr8: 22006950-22007073 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os08g0450800 |
| Parent gene annotation |
Phosphatidylinositol-4-phosphate 5-kinase family protein. (Os08t 0450800-01);Similar to predicted protein. (Os08t0450800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0450800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.31989543 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22006961-22006955(+) 22007070-22006955(+) 22007000-22007032(-) 22006986-22007039(-) |
| Potential amino acid sequence |
MVACFRYASIKVHSVYLPPPKLDFTSQHQEWVEQEANELW*(+) MSFGEMVACFRYASIKVHSVYLPPPKLDFTSQHQEWVEQEANELW*(+) MNLDRCISEASNHFTKAHLLLALPIPGAEK*(-) MHIGSKQPFHQSSFASCSTHSWC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |