Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0264300_circ_g.3 |
ID in PlantcircBase | osa_circ_030478 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 8721303-8722813 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0264300 |
Parent gene annotation |
Similar to RAD23, isoform I. (Os06t0264300-01);Similar to RAD23, isoform I. (Os06t0264300-02);Similar to DNA repair protein RAD2 3. (Os06t0264300-03) |
Parent gene strand | + |
Alternative splicing | Os06g0264300_circ_g.1 Os06g0264300_circ_g.2 Os06g0264300_circ_g.4 Os06g0264300_circ_g.5 Os06g0264300_circ_g.6 Os06g0264300_circ_g.7 Os06g0264300_circ_g.8 Os06g0264366_circ_g.1 Os06g0264366_circ_g.2 Os06g0264366_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0264300-02:3 Os06t0264300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.124724007 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8721370-8721312(+) |
Potential amino acid sequence |
MLIHQGKILKDDTTLEGNKVAENSFLVIMLSKAKASSSGASTASKAPVSQSQPATPVASVARTP PPQAPVVTPEPWLR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |