Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0264300_circ_g.3 |
| ID in PlantcircBase | osa_circ_030478 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 8721303-8722813 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0264300 |
| Parent gene annotation |
Similar to RAD23, isoform I. (Os06t0264300-01);Similar to RAD23, isoform I. (Os06t0264300-02);Similar to DNA repair protein RAD2 3. (Os06t0264300-03) |
| Parent gene strand | + |
| Alternative splicing | Os06g0264300_circ_g.1 Os06g0264300_circ_g.2 Os06g0264300_circ_g.4 Os06g0264300_circ_g.5 Os06g0264300_circ_g.6 Os06g0264300_circ_g.7 Os06g0264300_circ_g.8 Os06g0264366_circ_g.1 Os06g0264366_circ_g.2 Os06g0264366_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0264300-02:3 Os06t0264300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124724007 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8721370-8721312(+) |
| Potential amino acid sequence |
MLIHQGKILKDDTTLEGNKVAENSFLVIMLSKAKASSSGASTASKAPVSQSQPATPVASVARTP PPQAPVVTPEPWLR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |