Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0938600_circ_g.4 |
| ID in PlantcircBase | osa_circ_005750 |
| Alias | Os_ciR2651 |
| Organism | Oryza sativa |
| Position | chr1: 41206602-41207155 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0938600 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0938600-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0938600_circ_g.3 |
| Support reads | 5/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0938600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.309576414 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41207078-41206612(+) 41207125-41207149(-) |
| Potential amino acid sequence |
MSNSSFDAFPFSSGTILCSLKLATISAHRN*(+) MVPELNGNASKLELDIYEEIGIPNSTVVVNSLQLVGSNWTNVIFSIVPYPKNLTLSSTGLSILR SYFMSFVVRQSTLQLTESLFGNSSSFEVLKFPGGITIIPPQTAFLPQKPHATFNFTLNFPIYKV QDRIDELKDQMKTGLLLNSYELI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |