Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0620400_circ_g.1 |
| ID in PlantcircBase | osa_circ_009819 |
| Alias | Os_ciR4197 |
| Organism | Oryza sativa |
| Position | chr11: 24186197-24187554 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0620400 |
| Parent gene annotation |
Sugar/inositol transporter domain containing protein. (Os11t0620 400-01);Sugar/inositol transporter domain containing protein. (O s11t0620400-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0620400_circ_g.2 |
| Support reads | 8/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0620400-01:2 Os11t0620400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217479357 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24187474-24186276(+) 24186230-24187526(-) |
| Potential amino acid sequence |
MMKSTVFSAVAVSIGYTLLGWDFTTVLVEPASDRPNGHGRCEVPVFVGLQLLGL*(+) MSIRSVTCWFNQNGCKIPSK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |