Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0400800_circ_g.2 |
| ID in PlantcircBase | osa_circ_006746 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 13538578-13539915 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0400800 |
| Parent gene annotation |
Similar to Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20 ) (Phenylalanine--tRNA ligase alpha chain) (PheRS) (CML33). (Os1 0t0400800-01);Similar to Phenylalanyl-tRNA synthetase alpha chai n. (Os10t0400800-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0400800_circ_g.3 Os10g0400800_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0400800-02:5 Os10t0400800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.148152149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13539858-13538578(+) 13539691-13539890(-) |
| Potential amino acid sequence |
MNFLYFLKIIFRQLFCSGRG*(+) MLYKLAQEKPFAPKRYYSIDRVFRNEAVDRTHLAEFHQIEGLICDYGLTLGDLIGVLEDFFSSL GMSKLRFKPAYNPYTEPSMEIFSPCRYKTIA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |