Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G170700_circ_g.4 |
| ID in PlantcircBase | gma_circ_004978 |
| Alias | Gm19circRNA2424 |
| Organism | Glycine max |
| Position | chr19: 43144022-43145020 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_19G170700 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_19G170700_circ_g.1 GLYMA_19G170700_circ_g.2 GLYMA_19G170700_circ_g.3 GLYMA_19G170700_circ_g.5 |
| Support reads | NA |
| Tissues | root, stem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRG95788:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.246084952 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43144027-43144033(+) 43144110-43144927(-) |
| Potential amino acid sequence |
MINEGISQSILVSGESGAGKTESTKLLMRYLAYMGGRAAAAEGRTVEQKVLESNPVLEAFGNAK TVRNNNSSRFGKFVEIQFDQSGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAAPPEDVK KYKLGDPRMFHYLNQSNCFELEGVDESKEYRDTRRAMDIVGISSEEQAYDK*(+) MSNLVLSVLPAPLSPLTNIDWLIPSFIISLLLRTYSNNIHCSPCIPIFFRFINPFQLKAI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |