Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G05590_circ_g.3 |
ID in PlantcircBase | ath_circ_019904 |
Alias | At_ciR3212 |
Organism | Arabidpsis thaliana |
Position | chr3: 1621792-1622122 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, circseq_cup, CIRI-full |
Parent gene | AT3G05590 |
Parent gene annotation |
RPL18 |
Parent gene strand | + |
Alternative splicing | AT3G05590_circ_g.2 AT3G05590_circ_g.4 |
Support reads | 2/1 |
Tissues | leaf/root, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G05590.3:2 AT3G05590.2:2 AT3G05590.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.571056687 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1622060-1622119(+) |
Potential amino acid sequence |
MSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKF NGVILKRLFMSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRF LVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYL KLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |