Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G05590_circ_g.3 |
| ID in PlantcircBase | ath_circ_019904 |
| Alias | At_ciR3212 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 1621792-1622122 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ, circseq_cup, CIRI-full |
| Parent gene | AT3G05590 |
| Parent gene annotation |
RPL18 |
| Parent gene strand | + |
| Alternative splicing | AT3G05590_circ_g.2 AT3G05590_circ_g.4 |
| Support reads | 2/1 |
| Tissues | leaf/root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G05590.3:2 AT3G05590.2:2 AT3G05590.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.571056687 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1622060-1622119(+) |
| Potential amino acid sequence |
MSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKF NGVILKRLFMSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRF LVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGKGIDLIAGGKSKKTKRTAPKSDDVYL KLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFMTGK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |