Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0572400_circ_g.3 |
| ID in PlantcircBase | osa_circ_012077 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 23592382-23592535 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os12g0572400 |
| Parent gene annotation |
Similar to SC35-like splicing factor SCL30, 30 kD. (Os12t0572400 -01);Similar to Pre-mRNA splicing factor (Fragment). (Os12t05724 00-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0572400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.304391775 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23592507-23592480(+) 23592529-23592492(-) |
| Potential amino acid sequence |
MVGCTSSLFCLQLNGMLRTKRLPEPCSLRPPYPLLGGLLPLPP*(+) MRRYSPPYRSPPRRGYGGRGRSPPRRGYGGRREQGSGSLLVRNIPLSCRQNNEEVQPTISQSP* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |