Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0248000_circ_g.2 |
| ID in PlantcircBase | osa_circ_038533 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 3621550-3622336 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0248000 |
| Parent gene annotation |
D-aminoacyl-tRNA deacylase domain containing protein. (Os09t0248 000-01);D-aminoacyl-tRNA deacylase domain containing protein. (O s09t0248000-02);Similar to Ethanol tolerance protein GEKO1. (Os0 9t0248000-03);Similar to Ethanol tolerance protein GEKO1. (Os09t 0248000-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0248000-02:3 Os09t0248000-04:2 Os09t0248000-01:3 Os09t0248000-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.176109763 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3621557-3621596(+) 3621676-3622066(-) |
| Potential amino acid sequence |
MESFTNGDVRLLKHERSIIAEDDLDNRWQAATGEAVSEVIFLSKHTAVSNRPALTVHPIGVPHL REDETPPQGGRPGWAALPNPRIGPWLRLMQKIAVDQGLVPEFEITLEATHHGPVTNTPTMFVEI GGDGELYKRGRSTIEA*(+) MTSETASPVAACHRLSRSSSAMMLRSCFNSRTSPFVKLSIPSYLNKHRWCIGDWSMVSSFQCNL KLWNKTLVYRNLLHQTEPWTNSRIGQSCPSWSPSLRWRLIFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |