Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0198000_circ_g.1 |
| ID in PlantcircBase | osa_circ_000729 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 5313482-5315202 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0198000 |
| Parent gene annotation |
RNA-dependent RNA polymerase, eukaryotic-type domain containing protein. (Os01t0198000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0198000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120237483 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5315125-5315172(-) |
| Potential amino acid sequence |
MELLQTAIEEADNARFDYAGALNIAFNYADMEDSMPARMILSGIPLEESYLQSRLDFLSLLERK GIKNGKIPIDDCYYLMGTADPTGKLGPNEVCVILDYGQVSGDVLVYKYPGLHPGDIHVLKATYS SDIEKVVGNSKHAILFPTTGQRSLADEMANSDFDGDIYWVSLNPKQSIRKDIHIK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |