Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0573450_circ_g.7 |
ID in PlantcircBase | osa_circ_034473 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 23180476-23180831 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0573400 |
Parent gene annotation |
Protein of unknown function DUF239, plant domain containing prot ein. (Os07t0573400-01);Protein of unknown function DUF239, plant domain containing protein. (Os07t0573400-02) |
Parent gene strand | + |
Alternative splicing | Os07g0573450_circ_g.2 Os07g0573450_circ_g.3 Os07g0573450_circ_g.4 Os07g0573450_circ_g.5 Os07g0573450_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0573450-00:2 Os07t0573450-00:2 Os07t0573400-02:2 Os07t0573400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.288440684 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23180761-23180828(+) 23180792-23180742(+) |
Potential amino acid sequence |
MGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQINN QIAMGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQ INNQIAMGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSG FIQINNQIAMGASISPLSNYGGSQYDINILVWK(+) MVVPSMISIFWSGRLAQICMGTTTLDSSPTGLAMRIRQQDATTCCARGSYR*(+) |
Sponge-miRNAs | osa-miR2923 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |