Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0573450_circ_g.7 |
| ID in PlantcircBase | osa_circ_034473 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 23180476-23180831 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0573400 |
| Parent gene annotation |
Protein of unknown function DUF239, plant domain containing prot ein. (Os07t0573400-01);Protein of unknown function DUF239, plant domain containing protein. (Os07t0573400-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0573450_circ_g.2 Os07g0573450_circ_g.3 Os07g0573450_circ_g.4 Os07g0573450_circ_g.5 Os07g0573450_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0573450-00:2 Os07t0573450-00:2 Os07t0573400-02:2 Os07t0573400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.288440684 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23180761-23180828(+) 23180792-23180742(+) |
| Potential amino acid sequence |
MGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQINN QIAMGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQ INNQIAMGASISPLSNYGGSQYDINILVWKVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSG FIQINNQIAMGASISPLSNYGGSQYDINILVWK(+) MVVPSMISIFWSGRLAQICMGTTTLDSSPTGLAMRIRQQDATTCCARGSYR*(+) |
| Sponge-miRNAs | osa-miR2923 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |