Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045014_circ_g.2 |
ID in PlantcircBase | zma_circ_009842 |
Alias | Zm09circ00008, zma_circ_0002908, ZmciR370 |
Organism | Zea mays |
Position | chr9: 10223358-10224576 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d045014 |
Parent gene annotation |
chloroplast RNA splicing4 |
Parent gene strand | - |
Alternative splicing | Zm00001d045014_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d045014_T017:2 Zm00001d045014_T006:2 Zm00001d045014_T014:2 Zm00001d045014_T016:2 Zm00001d045014_T023:2 Zm00001d045014_T001:2 Zm00001d045014_T005:2 Zm00001d045014_T010:2 Zm00001d045014_T008:2 Zm00001d045014_T025:2 Zm00001d045014_T021:2 Zm00001d045014_T012:2 Zm00001d045014_T003:2 Zm00001d045014_T020:1 Zm00001d045014_T027:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.22411484 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10224483-10223388(+) 10223585-10224508(-) |
Potential amino acid sequence |
MVLRRDTMLYSPSPVTSTTDLGDSGEPWSEASYFPIRRQFEY*(+) MEAASFYKQMLRAGEKENGSASLMCSAFDALVSLEHGKMVHCRSMKSRFCFEMMHFKCGRLAAQ LILKLSSNGKIGCFTPGFTRISQICCTGHRGGGI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |