Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G28050_circ_g.1 |
| ID in PlantcircBase | ath_circ_024160 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 10443839-10443952 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G28050 |
| Parent gene annotation |
WAT1-related protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G28050.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.382304244 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10443855-10443949(+) |
| Potential amino acid sequence |
MGYTGINYSSPTLASAISNLTPAFTFLLAVVFRCCSNIMGYTGINYSSPTLASAISNLTPAFTF LLAVVFRCCSNIMGYTGINYSSPTLASAISNLTPAFTFLLAVVFRCCSNIMGYTGINYSSPTLA SAISNLTPAFTFLLAVVF(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |