Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0505302_circ_g.2 |
| ID in PlantcircBase | osa_circ_030994 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17957110-17958696 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0505302 |
| Parent gene annotation |
Similar to SWEETIE (SWEETIE); binding. (Os06t0505302-00) |
| Parent gene strand | - |
| Alternative splicing | Os06g0505302_circ_g.3 Os06g0505302_circ_g.4 Os06g0505302_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0505302-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133108738 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17958659-17957148(+) 17958637-17958678(-) |
| Potential amino acid sequence |
MKAVSASIATDRTLRKVAHFNIPDTW*(+) MTNANGGILLNPVLAYLGGALSLISSLSSKKLPNVNSALNLFTTRTLMAYQSLSNPMVYKSEHQ QMLQLCSSPFSDPSGWEESSCLKFLLDKRDNSLGPWIPGRDSFEDELRAFDGGVDGFLPCVWDV EMSNFPQCPVCCD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |