Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0294000_circ_g.2 |
ID in PlantcircBase | osa_circ_038753 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 7001199-7001643 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0294000 |
Parent gene annotation |
Similar to Bifunctional aspartokinase/homoserine dehydrogenase 2 , chloroplast precursor (AK-HD 2) (AK-HSDH 2) [Includes: Asparto kinase (EC 2.7.2.4); Homoserine dehydrogenase (EC 1.1.1.3)]. (Os 09t0294000-01);Similar to Aspartate kinase-homoserine dehydrogen ase. (Os09t0294000-02) |
Parent gene strand | - |
Alternative splicing | Os09g0294000_circ_g.1 Os09g0294000_circ_g.3 Os09g0294000_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0294000-01:2 Os09t0294000-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.350364401 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7001614-7001284(+) 7001283-7001639(-) |
Potential amino acid sequence |
MHAAESLISDTFWQHQFLIDHLLDLALYIQLLLLQQQHY*(+) MLLLKQKKLDIQSQIQEMIYQELMLPESI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |