Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0138900_circ_g.2 |
| ID in PlantcircBase | osa_circ_010452 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 1891201-1891569 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0138900 |
| Parent gene annotation |
Similar to Plastid isopropylmalate synthase (Fragment). (Os12t01 38900-01);Similar to Plastid isopropylmalate synthase (Fragment) . (Os12t0138900-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0138900_circ_g.3 |
| Support reads | 4 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0138900-01:2 Os12t0138900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009935 |
| PMCS | 0.608860027 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1891530-1891299(+) |
| Potential amino acid sequence |
MVLVKGLEMLLWKRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIE NAIISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVKQRVSISYTRGSHKS WSNNTQYPRHCWIHSSL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |