Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0138900_circ_g.2 |
ID in PlantcircBase | osa_circ_010452 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 1891201-1891569 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0138900 |
Parent gene annotation |
Similar to Plastid isopropylmalate synthase (Fragment). (Os12t01 38900-01);Similar to Plastid isopropylmalate synthase (Fragment) . (Os12t0138900-02) |
Parent gene strand | + |
Alternative splicing | Os12g0138900_circ_g.3 |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0138900-01:2 Os12t0138900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009935 |
PMCS | 0.608860027 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1891530-1891299(+) |
Potential amino acid sequence |
MVLVKGLEMLLWKRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIE NAIISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVKQRVSISYTRGSHKS WSNNTQYPRHCWIHSSL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |