Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0440300_circ_g.3 |
| ID in PlantcircBase | osa_circ_039350 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 16333524-16334768 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0440300 |
| Parent gene annotation |
Aldehyde dehydrogenase, Seed maturation, Maintenance of viabilit y during storage, Lysine catabolism (Os09t0440300-01);Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiqui tin 1) (Matured fruit 60 kDa protein) (MF-60). (Os09t0440300-02) ;Similar to Aldehyde dehydrogenase. (Os09t0440300-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0440300_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0440300-01:4 Os09t0440300-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.176461439 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16334761-16334761(-) |
| Potential amino acid sequence |
MVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLLLHESIYR TFLDQLVEVYKQVRIGDPLENGTLLGPLHTPASRDAFLKGIQTIRSQGGKILYGGSAIESEGNF VQPTIVEISPSAPVVREELFGPVLYVMKVQNLKEAVEINNSVPQGLSSSIFTKRPDIIFKWIGL V*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |