Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G38040_circ_g.5 |
ID in PlantcircBase | ath_circ_017164 |
Alias | At_ciR5876 |
Organism | Arabidpsis thaliana |
Position | chr2: 15918911-15919202 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT2G38040 |
Parent gene annotation |
Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha , chloroplastic |
Parent gene strand | + |
Alternative splicing | AT2G38040_circ_g.2 AT2G38040_circ_g.3 AT2G38040_circ_g.4 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G38040.1:2 AT2G38040.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.278754395 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15918941-15919199(+) |
Potential amino acid sequence |
MFGLKVPILSIVIGEGGSGGALAIGCANKMLMLENAVFYVASPEACAAILWKTSKAAPEGEAIA NNLRTMFGLKVPILSIVIGEGGSGGALAIGCANKMLMLENAVFYVASPEACAAILWKTSKAAPE GEAIANNLRTMFGLKVPILSIVIGEGGSGGALAIGCANKMLMLENAVFYVASPEACAAILWKTS KAAPEGEAIANNLRTMFGLKVPILSIVIGEGGSGGALAIGCANKMLMLENAVFYVASPEACAAI LWKTSKAAPE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |