Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0272500_circ_g.2 |
| ID in PlantcircBase | osa_circ_038682 |
| Alias | Os_ciR11995 |
| Organism | Oryza sativa |
| Position | chr9: 5447031-5449663 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0272500 |
| Parent gene annotation |
Similar to cation cation antiporter. (Os09t0272500-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0272500_circ_g.1 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0272500-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.09890477 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5449571-5447062(+) 5449575-5447090(+) 5449655-5449642(-) |
| Potential amino acid sequence |
MNEFSLVLLPRSRVKQPQQIHFSLTDAHCGISSLLLAQTGSS*(+) MSLAWFCCRGAESSNRSRFTSVLLMPIVGYLLCCLHRLVHHKTAILQLAC*(+) MGISKTEVNLLRLLDSAPRQQNQAKLIHYVTTSRELLEKLAAENTSEGISSIAKGRLNEYSERI EELAARLASLVPGYENAVEAIRKEESYLEGEQIRSPIALSPGLRRRLTALQEIEQPTNAKERNV AEPLRLDEAAQANIEKYRNLQEDLTDEIVELARQLKDSSLMMNQSVQATEKISHNGHQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |