Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G271500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000985 |
| Alias | Chr09:22695010|22695791 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 22695010-22695791 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G271500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G271500.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.776033397 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22695783-22695787(-) 22695752-22695128(+) |
| Potential amino acid sequence |
MYNPNYLERPYVVVLNKIDLPKARDKLPHLTEEILKIGSDIVHSELGMSSRDEVQSLPTEGGEA TTLSPAISVEDKMDKGIEDYPRPAAVVGVSVLN*(-) MVVLGNLDCTSSVQNTNTNNSSGPWIVLNSFIHFIFNRNRWRQCSRFATFSGQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |