Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0617900_circ_g.7 |
| ID in PlantcircBase | osa_circ_012343 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 26313246-26314095 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0617900 |
| Parent gene annotation |
Similar to Serine/threonine protein phosphatase. (Os12t0617900-0 1);Similar to Serine/threonine protein phosphatase BSL2 (EC 3.1. 3.16) (BSU1-like protein 2). (Os12t0617900-02);Similar to Serine /threonine protein phosphatase. (Os12t0617900-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0617900_circ_g.2 Os12g0617900_circ_g.3 Os12g0617900_circ_g.4 Os12g0617900_circ_g.5 Os12g0617900_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0617900-02:5 Os12t0617900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.243051412 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26313454-26314046(-) 26313253-26313820(-) 26313802-26314046(-) |
| Potential amino acid sequence |
MMGRGPWLMCGPLIQQLSHMSGGNLNQKVKDHPHACLAGATADVHCYDVSSNKWSRLTPVGEPP SPRAAHVATAVGTMVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALV GQRFLLTIGGNDGKRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMSCWCYCGCALLRCFIE*( -) MHVLLVLLRMCTATMFHRISGAGLLQLVNLLHQERHM*(-) MVVIQGGIGPAGLSAEDLHVLDLTQQRPRWHRVVVQGPGPGPRYGHVMALVGQRFLLTIGGNDG KRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMSCWCYCGCALLRCFIE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |