Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0436900_circ_g.2 |
ID in PlantcircBase | osa_circ_039302 |
Alias | Os_ciR11819 |
Organism | Oryza sativa |
Position | chr9: 16099902-16100420 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0436850 |
Parent gene annotation |
Hypothetical protein. (Os09t0436850-00) |
Parent gene strand | - |
Alternative splicing | Os09g0436900_circ_g.1 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0436900-01:3 Os09t0436850-00:3 Os09t0436900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.285011802 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16100412-16099928(+) 16099968-16099928(+) |
Potential amino acid sequence |
MHTGDAWKALFDLAGGLIQVYDQEAMLSLSKFVDQLPSVMNQVTEGVSEFKPTPPENREFCKNS YNVPNTLLVKFSIDAIDDTEIVEDVLKPRVESIGGQIKKVILSGTHLTPCIQEMHGRPYLI*(+ ) MLSLSKFVDQLPSVMNQVTEGVSEFKPTPPENREFCKNSYNVPNTLLVKFSIDAIDDTEIVEDV LKPRVESIGGQIKKVILSGTHLTPCIQEMHGRPYLI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |