Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G42500_circ_g.6 |
| ID in PlantcircBase | ath_circ_017953 |
| Alias | At_ciR4307, AT2G42500_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 17699176-17700174 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT2G42500 |
| Parent gene annotation |
Serine/threonine-protein phosphatase PP2A-3 catalytic subunit |
| Parent gene strand | - |
| Alternative splicing | AT2G42500_circ_g.1 AT2G42500_circ_g.2 AT2G42500_circ_g.3 AT2G42500_circ_g.4 AT2G42500_circ_g.5 AT2G42500_circ_g.7 AT2G42500_circ_g.8 AT2G42500_circ_g.9 AT2G42500_circ_g.10 |
| Support reads | 3/2 |
| Tissues | leaf/root, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G42500.2:4 AT2G42500.5:4 AT2G42500.4:4 AT2G42500.3:4 AT2G42500.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223467836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17700151-17699178(-) |
| Potential amino acid sequence |
MGDYVDRGYYSVETVTLLVALKMRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKIF TDLFDYFPLTALCPDTNYLFMGDYVDRGYYSVETVTLLVALKMRYPQRITILRGNHESRQITQV YGFYDECLRKYGNANVWKIFTDLFDYFPLTALCPDTNYLFMGDYVDRGYYSVETVTLLVALKMR YPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALCPDTNYLFMGDY VDRGYYSVETVTLLVALKMRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKIFTDLF DYFPLTAL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |