Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g094400.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000874 |
| Alias | 2:49510423|49511077, Slcirc049 |
| Organism | Solanum lycopersicum |
| Position | chr2: 54932573-54933227 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g094400.2 |
| Parent gene annotation |
Glycerophosphodiester phosphodiesterase GDPD2 |
| Parent gene strand | + |
| Alternative splicing | Solyc02g094400.2_circ_g.1 Solyc02g094400.2_circ_g.2 Solyc02g094400.2_circ_g.4 |
| Support reads | 64/60 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc02g094400.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.015943322 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54932670-54932666(+) |
| Potential amino acid sequence |
MRKTKDGKIVSWTVETDDSACTLKEAFEKVNPSIGFNIELKFDDHIVYQQDYLIHALKAVLHVV LEYAKGRPIIFSSFQPDAALLVKKLQTCYPVFFLTNGGTEIYYDVRRNSLEEATKLCLEGGLEG IVSEVKGIFRNPGVVNKIKESKLSLLTYGKLKVQFMKGELLNCHLLNFLAMDPKKKRVSLENL* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018; Wang et al., 2018b |