Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0586500_circ_g.5 |
| ID in PlantcircBase | osa_circ_034587 |
| Alias | Os_ciR11063 |
| Organism | Oryza sativa |
| Position | chr7: 23837389-23838931 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0586500 |
| Parent gene annotation |
Similar to predicted protein. (Os07t0586500-01);Similar to SUMO activating enzyme 2. (Os07t0586500-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0586500_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0586550-00:5 Os07t0586500-02:4 Os07t0586500-01:4 Os07t0586550-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228748585 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23838331-23837593(+) 23838866-23837444(+) |
| Potential amino acid sequence |
MTYCLEHPSRKMLLMPIEPFEPNKSCYVCSETPLLLEVNTKTTKLREVIEKIIKSKLGMNLPLV MIGSTLVFEDGEGLEEDEAANYALNLEKVLAELPAPVVNDTKLTVEDFQQELSCSINIKHSLFT ALFGQRSCFLQKCLGIKTRTMILMSVQMKAALRNQMYLKEMQMKILINMLGEFMIMSLVTTSKW P*(+) MTQSLLLRIFSRNCHAALTLNTVCSLHCLGKGVAFCKNVWG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |