Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0346200_circ_g.3 |
| ID in PlantcircBase | osa_circ_006508 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 10385943-10386051 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0346200 |
| Parent gene annotation |
Zinc finger, RING-type domain containing protein. (Os10t0346200- 01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0346200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.334200382 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10385953-10385968(+) 10385975-10385968(+) 10385955-10385993(-) |
| Potential amino acid sequence |
MTRKGANYVERQNSEISYYADDEDANRKKYTKRAECHDKKRC*(+) MLRDKIQRFLIMLMMRTQTARSIPKGPSAMTRKGANYVERQNSEISYYADDEDANRKKYTKRAE CHDKKRC*(+) MALGPFGILLAVCVLIISIIRNL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |