Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0626900_circ_g.2 |
| ID in PlantcircBase | osa_circ_002778 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 25032066-25032466 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0626900 |
| Parent gene annotation |
Helix-loop-helix DNA-binding domain containing protein. (Os01t06 26900-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0626900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125954219 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25032195-25032087(+) 25032175-25032436(-) |
| Potential amino acid sequence |
MSSRTKNHKGKGFSCKCDRLTQSHGKTQQGEQTFGCCNKSSTKGSKAYCCSVLKFCYIPAILAH LHQLVISKDPNIHYYCSHLLHNAESLKFNLNIHSQFLHTQCRQEQRTTKEKDSPVNVTASHNHT EKHSKVNRLSAAVISRVQRGPRHTAAQCLSFVIFLQSWHTCINW*(+) MYVKVELKRFRIVKEVGTIVMNVRIFAYYQLMQVCQDCRNITKLKH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |