Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0640500_circ_g.4 |
| ID in PlantcircBase | osa_circ_025551 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 32578669-32579199 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0640500 |
| Parent gene annotation |
ABC-1 domain containing protein. (Os04t0640500-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0640500_circ_g.1 Os04g0640500_circ_g.2 Os04g0640500_circ_g.3 Os04g0640500_circ_g.5 Os04g0640500_circ_g.6 Os04g0640500_circ_g.7 Os04g0640500_circ_g.8 Os04g0640500_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0640500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1899301 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32578747-32578707(+) |
| Potential amino acid sequence |
MYKFKFQIPSYFSLVIRSLAVLEGIAISFNPNYKVLGSSYPWIARKVLTDSSPKLRSTLQTLLY KVYFKMLLTEGCKI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |