Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0640500_circ_g.4 |
ID in PlantcircBase | osa_circ_025551 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 32578669-32579199 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0640500 |
Parent gene annotation |
ABC-1 domain containing protein. (Os04t0640500-01) |
Parent gene strand | + |
Alternative splicing | Os04g0640500_circ_g.1 Os04g0640500_circ_g.2 Os04g0640500_circ_g.3 Os04g0640500_circ_g.5 Os04g0640500_circ_g.6 Os04g0640500_circ_g.7 Os04g0640500_circ_g.8 Os04g0640500_circ_g.9 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0640500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1899301 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32578747-32578707(+) |
Potential amino acid sequence |
MYKFKFQIPSYFSLVIRSLAVLEGIAISFNPNYKVLGSSYPWIARKVLTDSSPKLRSTLQTLLY KVYFKMLLTEGCKI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |