Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0108350_circ_g.3 |
| ID in PlantcircBase | osa_circ_026207 |
| Alias | Os_ciR10229 |
| Organism | Oryza sativa |
| Position | chr5: 473595-473752 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0108350 |
| Parent gene annotation |
Hypothetical protein. (Os05t0108350-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0108300-01:1 Os05t0108350-00:1 Os05t0108300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.370258755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
473659-473625(+) 473610-473648(+) |
| Potential amino acid sequence |
MHLGCVYWSLLHLSTHIVNVPMQRRYTRKYLMHTGIYGSRTL*(+) MAPELYDEEYNELVDIYAFGMCLLELVTFEYPYCECSNAAQIYKKVSDAHRNLWLQNSMMKNTM SL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |