Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0538800_circ_g.5 |
| ID in PlantcircBase | osa_circ_040051 |
| Alias | Os_ciR3235 |
| Organism | Oryza sativa |
| Position | chr9: 21217232-21217392 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0538800 |
| Parent gene annotation |
Similar to Synaptotagmin C. (Os09t0538800-01);Similar to Synapto tagmin C. (Os09t0538800-02);Similar to calcium lipid binding pro tein-like. (Os09t0538800-03) |
| Parent gene strand | - |
| Alternative splicing | Os09g0538901_circ_g.1 Os09g0538901_circ_g.2 Os09g0538901_circ_g.3 Os09g0538800_circ_g.1 Os09g0538901_circ_g.2 Os09g0538800_circ_g.3 Os09g0538901_circ_g.4 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0538800-03:1 Os09t0538800-01:1 Os09t0538800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239722308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21217344-21217389(-) |
| Potential amino acid sequence |
MGVISTVLGFSGFGFGFSAGIVIGYYFFIYFQPTDVKP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |