Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0366400_circ_g.1 |
| ID in PlantcircBase | osa_circ_006617 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 11460508-11460794 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os10g0366400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os10t0366400-01);Hypothetical c onserved gene. (Os10t0366400-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 17 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0366400-01:1 Os10t0366400-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.094947735 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11460525-11460521(+) |
| Potential amino acid sequence |
MEPEGGVRLPTLDRVRRGVRSSCDTESWECFQCGSINLPVEKLLFDLPAFHCRGCEAPFLGEMN FCYDLVKANKRSLIGGLDNIKNQYDNPLGDL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |