Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0532200_circ_g.6 |
| ID in PlantcircBase | osa_circ_002004 |
| Alias | Os_ciR5802 |
| Organism | Oryza sativa |
| Position | chr1: 19184103-19184332 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0532200 |
| Parent gene annotation |
FF domain domain containing protein. (Os01t0532200-01);Hypotheti cal conserved gene. (Os01t0532200-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0532200_circ_g.3 Os01g0532200_circ_g.4 Os01g0532200_circ_g.5 Os01g0532200_circ_g.7 Os01g0532200_circ_g.8 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0532200-01:2 Os01t0532200-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239202609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19184191-19184105(-) |
| Potential amino acid sequence |
MTTSWTLEDFETAVTEDDTLKGITNINMKYQDDKARIKEAVKSGKIPMTTSWTLEDFETAVTED DTLKGITNINMKYQDDKARIKEAVKSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMKYQDDK ARIKEAVKSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |