Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G09840_circ_g.10 |
| ID in PlantcircBase | ath_circ_020733 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3021641-3021712 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G09840 |
| Parent gene annotation |
AT3G09840 protein |
| Parent gene strand | + |
| Alternative splicing | AT3G09840_circ_g.7 AT3G09840_circ_g.8 AT3G09840_circ_g.9 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G09840.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350696296 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3021669-3021709(+) |
| Potential amino acid sequence |
MILEVLRMSRESSRRLWRFPTSLGMILEVLRMSRESSRRLWRFPTSLGMILEVLRMSRESSRRL WRFPTSLGMILEVLRMSRESSR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |