Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G006400_circ_g.2 |
| ID in PlantcircBase | gra_circ_000553 |
| Alias | Chr06:1275137|1275719 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 1275137-1275719 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G006400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 12/28 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G006400.4:2 Gorai.006G006400.6:2 Gorai.006G006400.1:2 Gorai.006G006400.5:2 Gorai.006G006400.3:2 Gorai.006G006400.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000272 ghi_circ_000125* |
| PMCS | 1.111206518 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1275668-1275716(-) |
| Potential amino acid sequence |
MAEAQGEKVGDHEPRVSNKDASISPSNSEDVDKYRRVTVHSNNLENNTNSLATNQKYVEKKPCK KLESPVRKLMIENDVEGISTKVEQREKSCGELPDLNLPVYPMQSEK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |