Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g007840.2_circ_g.1 |
ID in PlantcircBase | sly_circ_003057 |
Alias | 10:2048333|2049608 |
Organism | Solanum lycopersicum |
Position | chr10: 2048333-2049608 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g007840.2 |
Parent gene annotation |
Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mit ochondrial |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 7 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc10g007840.2.1:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.184020559 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2049316-2048357(+) 2049368-2049587(-) |
Potential amino acid sequence |
MHHNNQQTEHMSPLGFSFSPQHLSLRHEIPHKGSSTHQQKLVSHTSSNAALII*(+) MRILMGTYALSAGYYDAYYKRAQQVRTLVRESFRAALDENDILISPAAPSAAYKIGEKKNDPLS MYAGDIMTVNVNLAGLPALVLPCGFVDSSSVALPVGVQMISAAFEEVWETSFC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |