Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0657000_circ_g.2 |
ID in PlantcircBase | osa_circ_020867 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 25635862-25638099 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0657000 |
Parent gene annotation |
TATA-binding protein TBP2. (Os03t0657000-01) |
Parent gene strand | + |
Alternative splicing | Os03g0657000_circ_g.1 Os03g0657000_circ_g.3 Os03g0657000_circ_g.4 Os03g0657000_circ_g.5 Os03g0657000_circ_g.6 Os03g0657000_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0657000-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013383 |
PMCS | 0.134824255 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25636576-25635939(+) 25636578-25638072(-) |
Potential amino acid sequence |
MRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQKLGFPAKFKDFKIQNIVGSCDVK FPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLLIFVSGKIVLTGAKKHRIDGQFGLQIR PQSYSFASSQCRI*(+) MITAAKRFGLYSALRACKAIALRSNLQSKLTVDTMFLCSGQNNLA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |