Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0531300_circ_g.1 |
| ID in PlantcircBase | osa_circ_024662 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 26566506-26567168 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0531300 |
| Parent gene annotation |
tRNA-dihydrouridine synthase domain containing protein. (Os04t05 31300-01);tRNA-dihydrouridine synthase domain containing protein . (Os04t0531300-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0531300_circ_g.2 Os04g0531300_circ_g.3 Os04g0531300_circ_g.4 Os04g0531300_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0531300-01:2 Os04t0531300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1490931 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26567123-26566569(+) |
| Potential amino acid sequence |
MGTSDAVRALKAAQLVVPCRLGYWLLNMVLISLTEKK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |