Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G20850_circ_g.15 |
| ID in PlantcircBase | ath_circ_031905 |
| Alias | AT4G20850_C3, AT4G20850_C3 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 11165070-11165240 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G20850 |
| Parent gene annotation |
Tripeptidyl-peptidase 2 |
| Parent gene strand | - |
| Alternative splicing | AT4G20850_circ_g.5 AT4G20850_circ_g.6 AT4G20850_circ_g.7 AT4G20850_circ_g.8 AT4G20850_circ_g.9 AT4G20850_circ_g.10 AT4G20850_circ_g.11 AT4G20850_circ_g.12 AT4G20850_circ_g.13 AT4G20850_circ_g.14 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G20850.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.455526121 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11165143-11165072(-) |
| Potential amino acid sequence |
MELAIAQFWSSGLGSREPTIVDFEVCPLRRPIKWESAPTFASPSAKSFVFPVVSGQTMELAIAQ FWSSGLGSREPTIVDFEVCPLRRPIKWESAPTFASPSAKSFVFPVVSGQTMELAIAQFWSSGLG SREPTIVDFEVCPLRRPIKWESAPTFASPSAKSFVFPVVSGQTMELAIAQFWSSGLGSREPTIV DFE |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |