Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G79700_circ_g.4 |
| ID in PlantcircBase | ath_circ_011075 |
| Alias | Ath_circ_FC5593 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29992089-29993404 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G79700 |
| Parent gene annotation |
Integrase-type DNA-binding superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT1G79700_circ_g.1 AT1G79700_circ_g.2 AT1G79700_circ_g.3 |
| Support reads | 2 |
| Tissues | inflorescences, seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G79700.2:4 AT1G79700.1:4 AT1G79700.4:3 AT1G79700.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120998607 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29992133-29992091(-) |
| Potential amino acid sequence |
MEGQSKEEYIGSLRRHRWTGRYEAHLWDKNSWNDTQTKKGRQVYLGAYDEEEAAARAYDLAALK YWGRDTLLNFPLPSYDEDVKEMEGQSKEEYIGSLRRHRWTGRYEAHLWDKNSWNDTQTKKGRQV YLGAYDEEEAAARAYDLAALKYWGRDTLLNFPLPSYDEDVKEMEGQSKEEYIGSLRRHRWTGRY EAHLWDKNSWNDTQTKKGRQVYLGAYDEEEAAARAYDLAALKYWGRDTLLNFPLPSYDEDVKEM EGQSKEEYIGSLR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |