Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G79700_circ_g.4 |
ID in PlantcircBase | ath_circ_011075 |
Alias | Ath_circ_FC5593 |
Organism | Arabidpsis thaliana |
Position | chr1: 29992089-29993404 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G79700 |
Parent gene annotation |
Integrase-type DNA-binding superfamily protein |
Parent gene strand | - |
Alternative splicing | AT1G79700_circ_g.1 AT1G79700_circ_g.2 AT1G79700_circ_g.3 |
Support reads | 2 |
Tissues | inflorescences, seed, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G79700.2:4 AT1G79700.1:4 AT1G79700.4:3 AT1G79700.3:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.120998607 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29992133-29992091(-) |
Potential amino acid sequence |
MEGQSKEEYIGSLRRHRWTGRYEAHLWDKNSWNDTQTKKGRQVYLGAYDEEEAAARAYDLAALK YWGRDTLLNFPLPSYDEDVKEMEGQSKEEYIGSLRRHRWTGRYEAHLWDKNSWNDTQTKKGRQV YLGAYDEEEAAARAYDLAALKYWGRDTLLNFPLPSYDEDVKEMEGQSKEEYIGSLRRHRWTGRY EAHLWDKNSWNDTQTKKGRQVYLGAYDEEEAAARAYDLAALKYWGRDTLLNFPLPSYDEDVKEM EGQSKEEYIGSLR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |