Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d047873_circ_g.1 |
| ID in PlantcircBase | zma_circ_003027 |
| Alias | circ1415 |
| Organism | Zea mays |
| Position | chr9: 143973239-143974237 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Zm00001d047873 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d047873_circ_g.2 Zm00001d047873_circ_g.3 |
| Support reads | 8 |
| Tissues | seedling leaves |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-TA |
| Number of exons covered | Zm00001d047873_T013:3 Zm00001d047873_T014:3 Zm00001d047873_T005:3 Zm00001d047873_T007:3 Zm00001d047873_T016:3 Zm00001d047873_T010:3 Zm00001d047873_T020:3 Zm00001d047873_T012:3 Zm00001d047873_T003:3 Zm00001d047873_T001:3 Zm00001d047873_T009:3 Zm00001d047873_T015:3 Zm00001d047873_T011:3 Zm00001d047873_T004:3 Zm00001d047873_T002:3 Zm00001d047873_T017:3 Zm00001d047873_T019:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.276275993 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
143974140-143973301(+) |
| Potential amino acid sequence |
MSTPSKAGHANSIDQDISPLKVDLRSEAKIAAEGLFKQTETMAGSIEQRWSHFG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2017b |