Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d047873_circ_g.1 |
ID in PlantcircBase | zma_circ_003027 |
Alias | circ1415 |
Organism | Zea mays |
Position | chr9: 143973239-143974237 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI |
Parent gene | Zm00001d047873 |
Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
Parent gene strand | + |
Alternative splicing | Zm00001d047873_circ_g.2 Zm00001d047873_circ_g.3 |
Support reads | 8 |
Tissues | seedling leaves |
Exon boundary | Yes-Yes |
Splicing signals | GT-TA |
Number of exons covered | Zm00001d047873_T013:3 Zm00001d047873_T014:3 Zm00001d047873_T005:3 Zm00001d047873_T007:3 Zm00001d047873_T016:3 Zm00001d047873_T010:3 Zm00001d047873_T020:3 Zm00001d047873_T012:3 Zm00001d047873_T003:3 Zm00001d047873_T001:3 Zm00001d047873_T009:3 Zm00001d047873_T015:3 Zm00001d047873_T011:3 Zm00001d047873_T004:3 Zm00001d047873_T002:3 Zm00001d047873_T017:3 Zm00001d047873_T019:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.276275993 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
143974140-143973301(+) |
Potential amino acid sequence |
MSTPSKAGHANSIDQDISPLKVDLRSEAKIAAEGLFKQTETMAGSIEQRWSHFG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chen et al., 2017b |