Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0710000_circ_g.2 |
ID in PlantcircBase | osa_circ_003587 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 29502146-29503701 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0710000 |
Parent gene annotation |
Similar to WD-repeat protein RBAP1. (Os01t0710000-01) |
Parent gene strand | + |
Alternative splicing | Os01g0710000_circ_g.1 Os01g0710000_circ_g.3 Os01g0710000_circ_g.4 Os01g0710000_circ_g.5 Os01g0710000_circ_g.6 Os01g0710000_circ_g.7 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0710000-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.116330988 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29503385-29502879(+) |
Potential amino acid sequence |
MESRPDLILRGHKDIAEFALAMCPAEPYVLSGGGDPSLRRLPTRIVSVFTFQSRRMGLSLILWL LQIVKLSNQGLQLLNIYLSSMRKHDHLL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |