Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0121600_circ_g.6 |
ID in PlantcircBase | osa_circ_026346 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 1157338-1157448 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0121600 |
Parent gene annotation |
AP2/EREBP family transcription factor, Starch biosynthesis (Os05 t0121600-01) |
Parent gene strand | - |
Alternative splicing | Os05g0121600_circ_g.1 Os05g0121600_circ_g.2 Os05g0121600_circ_g.3 Os05g0121600_circ_g.4 Os05g0121600_circ_g.5 Os05g0121600_circ_g.7 Os05g0121600_circ_g.8 Os05g0121600_circ_g.9 Os05g0121600_circ_g.10 Os05g0121600_circ_g.11 Os05g0121600_circ_g.12 Os05g0121600_circ_g.13 Os05g0121600_circ_g.14 Os05g0121600_circ_g.15 Os05g0121600_circ_g.16 Os05g0121600_circ_g.17 Os05g0121600_circ_g.18 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0121600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.098348348 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1157360-1157352(+) |
Potential amino acid sequence |
MRLGSPDWRMLGQKREPMRAASKFRGSCIILIIWE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |