Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0447800_circ_g.7 |
| ID in PlantcircBase | osa_circ_033644 |
| Alias | Os_ciR4059 |
| Organism | Oryza sativa |
| Position | chr7: 15347484-15349109 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0447800 |
| Parent gene annotation |
Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III domain containing protein. (Os07t0447800-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0447800_circ_g.6 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0447800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140797181 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15347487-15347528(+) |
| Potential amino acid sequence |
MFPNHIPNPEDKTAMKAITQAVADNKADLGIIFDTDVDRSAAVDSSGRELNRNRLIALMSAIVL EEHPGTTIVTDSVTSDGLTTFIENKLGGKHHRFKRGYKNVIDEAIRLNTIGEESHLAMETSGHG ALKENHWLDDGAYLMACFQITFQILRTKLQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |