Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0407700_circ_g.1 |
| ID in PlantcircBase | osa_circ_033465 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12654772-12655129 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0407700 |
| Parent gene annotation |
Hypothetical conserved gene. (Os07t0407700-01);Conserved hypothe tical protein. (Os07t0407700-02);Hypothetical conserved gene. (O s07t0407700-03);Hypothetical conserved gene. (Os07t0407700-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0407700-02:1 Os07t0407700-03:1 Os07t0407700-04:1 Os07t0407700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21343622 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12655050-12654858(+) 12655102-12654811(+) |
| Potential amino acid sequence |
MEPSWIGSVLEQTLQFWNDFLEHGSNLLLRCHSSPTRQHQLIENLLPCLSQCLSLS*(+) MTSWNMAPIFCFGVTLHLLDSTN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |