Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038150_circ_g.2 |
ID in PlantcircBase | zma_circ_009107 |
Alias | Zm06circ00082, GRMZM2G359365_C1 |
Organism | Zea mays |
Position | chr6: 149500381-149500990 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d038150 |
Parent gene annotation |
Probable manganese-transporting ATPase PDR2 |
Parent gene strand | - |
Alternative splicing | Zm00001d038150_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d038150_T006:3 Zm00001d038150_T011:3 Zm00001d038150_T002:3 Zm00001d038150_T009:3 Zm00001d038150_T001:3 Zm00001d038150_T004:1 Zm00001d038150_T005:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.23320964 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
149500528-149500956(-) |
Potential amino acid sequence |
MITGDQALTACHVASQVHISSKPVLILTRIKTGGFEWVSPDETDRAPYRLVKLEVWKGIK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |