Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d038150_circ_g.2 |
| ID in PlantcircBase | zma_circ_009107 |
| Alias | Zm06circ00082, GRMZM2G359365_C1 |
| Organism | Zea mays |
| Position | chr6: 149500381-149500990 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d038150 |
| Parent gene annotation |
Probable manganese-transporting ATPase PDR2 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d038150_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d038150_T006:3 Zm00001d038150_T011:3 Zm00001d038150_T002:3 Zm00001d038150_T009:3 Zm00001d038150_T001:3 Zm00001d038150_T004:1 Zm00001d038150_T005:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23320964 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
149500528-149500956(-) |
| Potential amino acid sequence |
MITGDQALTACHVASQVHISSKPVLILTRIKTGGFEWVSPDETDRAPYRLVKLEVWKGIK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |