Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G48090_circ_g.25 |
| ID in PlantcircBase | ath_circ_006250 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17750771-17750992 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G48090 |
| Parent gene annotation |
calcium-dependent lipid-binding family protein |
| Parent gene strand | - |
| Alternative splicing | AT1G48090_circ_g.22 AT1G48090_circ_g.23 AT1G48090_circ_g.24 AT1G48090_circ_g.26 AT1G48090_circ_g.27 AT1G48090_circ_g.28 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G48090.3:1 AT1G48090.1:1 AT1G48090.6:1 AT1G48090.2:1 AT1G48090.5:1 AT1G48090.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.413581298 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17750876-17750773(-) |
| Potential amino acid sequence |
MEDFTNQPILSPILEKADNVYSLIDRCGMAVIVDQDTRSEEQRQNLYSRFCISGRDIAAFFTDC GSDNQGCSLVMEDFTNQPILSPILEKADNVYSLIDRCGMAVIVDQDTRSEEQRQNLYSRFCISG RDIAAFFTDCGSDNQGCSLVMEDFTNQPILSPILEKADNVYSLIDRCGMAVIVDQDTRSEEQRQ NLYSRFCISGRDIAAFFTDCGSDNQGCSLVMEDFTNQPILSPILEKADNVYSLIDRCGMAVIVD Q(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |